PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa002464
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family Dof
Protein Properties Length: 285aa    MW: 31823.8 Da    PI: 10.0631
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58679109PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-26319PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.47.4e-3957115361
     zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                +++l+cprCds+ntkfCyynny+l+qPryfCk+CrryWtkGGalrnvP+Ggg+rknk +
  Lsa002464  57 NHHLRCPRCDSSNTKFCYYNNYNLTQPRYFCKTCRRYWTKGGALRNVPIGGGCRKNKGT 115
                67899***************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.4E-3259113IPR003851Zinc finger, Dof-type
ProDomPD0074786.0E-2560113IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.26460114IPR003851Zinc finger, Dof-type
PROSITE patternPS0136106298IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
KACILHAFIL LHTRKQKMME ELFTAPQPNV PTNSQILKPS PPAPPSSATN TPNSSENHHL  60
RCPRCDSSNT KFCYYNNYNL TQPRYFCKTC RRYWTKGGAL RNVPIGGGCR KNKGTTIAAA  120
LANHNISNTS KLKAVLSSEL GKTGFMNGFQ HSDPIFWASL PQTSHLLPLL RPTQNPNPNF  180
ALNPVTHTNT FSSSWRNSQT EQNQREENGG IINTGNNLNL GRMYQRLRSF PSNYSYHHDN  240
QTPPVMNTLS SSVMESPPAV SNGEPGLWNP TLPWSDLLLT NAAYR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002310753.16e-69hypothetical protein POPTR_0007s11620g
TrEMBLA0A103YH632e-90A0A103YH63_CYNCS; Zinc finger, Dof-type
STRINGPOPTR_0007s11620.12e-68(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.12e-35TARGET OF MONOPTEROS 6